-20%
VIP Peptide
VIP Peptide
VIP - Image 3
VIP Peptide
VIP Peptide
VIP - Image 3
(5 customer reviews)

VIP

Original price was: $81.00.Current price is: $65.00.

Peak Lab Purity Guarantee

Member Price: $52.00 Become a member →
VIP Peptide
This item: VIP
Original price was: $81.00.Current price is: $65.00.
Original price was: $81.00.Current price is: $65.00.
Research Spray Kit
1 × Research Spray Kit
Original price was: $35.00.Current price is: $28.00.
✓ ...
✓ 99%+ purity guaranteed
✓ USA Lab Verified

Become a Member and save 20% on Every Order. 

Become a Member

Monthly Membership
Yearly Membership
Lifetime Membership
EMAIL US FOR WHOLESALE PRICING
Orders of $5,000 or more

Description

VIP (Vasoactive Intestinal Peptide) – 10mg (Lyophilized Peptide in 3ml Vial) – For Research Use Only

VIP (Vasoactive Intestinal Peptide) is a naturally occurring neuropeptide and immunomodulator studied for its effects on vasodilation, smooth muscle relaxation, immune regulation, and neuroprotection. It plays a crucial role in gastrointestinal, pulmonary, and central nervous system signaling.

In research models, VIP has shown promise in areas such as inflammatory and autoimmune disease, lung function, and gut-brain axis modulation.

Product Details:

Peptide: VIP (Vasoactive Intestinal Peptide)

Purity: >98%

Form: Lyophilized powder

Quantity: 10mg per vial

Vial Size: 3ml sterile glass vial

Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

Neuroprotection and brain-gut axis studies

Pulmonary function and airway inflammation models

Immune system modulation and anti-inflammatory research

Gastrointestinal motility and secretory regulation

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease

Description

VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It binds to G protein–coupled receptors VPAC1 and VPAC2 to activate cAMP-dependent signaling pathways that mediate smooth muscle relaxation, vasodilation, immune modulation, and neuroendocrine communication.

VIP is widely used in research models to explore peptide-regulated vascular tone, neuroimmune interactions, epithelial homeostasis, and anti-inflammatory signaling. Its distribution across central and peripheral tissues makes it a versatile tool in both neuroscience and immunophysiology studies.

Overview
  • Peptide Name: Vasoactive Intestinal Peptide (VIP)
  • Sequence: HSDAVFTDNYSRVRSRFLEYSCRKRKQQ-NH₂
  • Length: 28 amino acids
  • Molecular Weight: ~3,327 Da
  • Receptor Targets: VPAC1, VPAC2 (Class B GPCRs)
  • Purity: ≥98% (HPLC verified)
  • Format: Lyophilized powder, 10mg vial

Use: For laboratory research only, not for clinical or diagnostic use

Reviews (5)

5 reviews for VIP

  1. Timothy –

    Consistent quality keeps me coming back.

  2. Jonathan –

    No complaints so far—every order has gone smoothly.

  3. Melissa –

    A great balance between price, quality, and service.

  4. Benjamin –

    Delivery timelines have always been accurate and dependable.

  5. Rebecca –

    The store has earned my trust through consistency.

Add a review

Your email address will not be published. Required fields are marked *

Research

1. Neuroimmune Signaling and Inflammatory Regulation

VIP is used to study cytokine modulation in immune cells including T lymphocytes, macrophages, and dendritic cells. It is involved in downregulating pro-inflammatory mediators (e.g., TNF-α, IL-6) and upregulating anti-inflammatory cytokines like IL-10 in in-vitro and animal models.

2. Vascular and Smooth Muscle Physiology

Through VPAC1/VPAC2 activation, VIP induces relaxation in smooth muscle tissues such as airway, vascular, and gastrointestinal smooth muscle. These properties are often evaluated in cardiovascular or pulmonary research for assessing vasodilatory and bronchodilatory mechanisms.

3. Epithelial Barrier Integrity

VIP has been studied in gut and respiratory epithelial models where it enhances tight-junction protein expression, aiding in barrier maintenance and regulating permeability. This is relevant in preclinical studies on inflammatory bowel disease (IBD) and respiratory epithelial dysfunction.

4. Neuroprotective and Synaptic Maintenance Studies

VIP has been shown to support neurotrophic factor expression and synaptic homeostasis. It is used in neurodegenerative models and CNS-focused research to evaluate neuroplasticity, synapse maintenance, and neuron-glia signaling.

5. Anti-Fibrotic Pathway Exploration

Preclinical studies indicate that VIP downregulates fibrotic markers in lung and cardiac models, making it useful in research investigating peptide-regulated fibrotic and remodeling processes in chronic disease contexts.

FAQ 

Q: What receptors does VIP target?
A: VIP primarily binds to VPAC1 and VPAC2 receptors, activating cAMP-mediated intracellular signaling cascades.

Q: Is VIP used in cardiovascular research?
A: Yes, due to its potent vasodilatory effects, VIP is often studied for its impact on vascular tone and smooth muscle relaxation.

Q: Does VIP play a role in immune modulation?
A: Yes, VIP has been shown to regulate immune responses by modulating cytokine production and inflammatory signaling.

Q: Can VIP be used in brain research?
A: Absolutely. VIP is involved in neurotrophic signaling, synaptic maintenance, and neuron-glia interactions, making it valuable in CNS-focused research.

Q: Is this peptide intended for clinical use?
A: No. VIP 10mg is strictly for laboratory research and preclinical use. It is not approved for human consumption or therapeutic applications.

Shipping & Delivery

Storage & Handling

All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly.

  • On arrival: Store vials in a cool, dry place away from heat and direct sunlight.
  • Long-term (powder): For optimal longevity, keep lyophilized peptides refrigerated to help maintain integrity.
  • After reconstitution: Use an appropriate research diluent (for example, BAC water). Store the reconstituted solution in the refrigerator and use within 20–30 days for best stability.

Note: Minimize exposure to moisture and repeated freeze–thaw cycles. Follow your institution's safety procedures when handling research materials.

Peak Lab Peptides maintains quality-control processes and routinely performs third-party testing to support purity and identity verification. COAs are available upon request for applicable batches. Documentation may vary depending on production timelines.

We aim to make batch-level documentation available whenever possible. Our goal is to expand COA access across the full catalog as production capacity grows.

All products are for laboratory research use only and are not intended for human consumption.

Related Products

-20%
Acetic Acid 0.6

Acetic Acid 0.6%

, , ,
Price range: $12.80 through $16.00

Acetic Acid 0.6% – 10ml (Sterile Solution) – For Laboratory Use Only

Acetic Acid 0.6% is a sterile, aqueous solution commonly used in research and lab settings for pH adjustment, buffer preparation, and preservative applications. Its mild acidic properties make it suitable for studies involving topical antimicrobial effects, cellular environment modification, and reagent preparation.This solution is intended for controlled research environments requiring low-concentration acetic acid in a sterile, injectable-grade format.

Product Details:

Compound: Acetic Acid 0.6% in sterile waterVolume: 10ml multi-dose vialForm: Sterile solutionConcentration: 0.6% w/vStorage: Store at 68–77°F (20–25°C); protect from light and contaminationGrade: For laboratory research only. Not for human or animal use in therapeutic or diagnostic procedures.

Potential Research Applications:

pH regulation and buffer system studiesTopical antimicrobial and cytotoxicity researchReagent dilution and formulation preparationLaboratory protocol requiring acidic conditionsFor laboratory use only. This product is not intended to diagnose, treat, cure, or prevent any disease.
Select options This product has multiple variants. The options may be chosen on the product page
-20%
Ara-290

Ara-290 (10mg)

, , , ,
Original price was: $50.00.Current price is: $40.00.

ARA-290 (Cibinetide)

ARA-290 – 10mg (Lyophilized Peptide) – For Research Use Only

ARA-290 is a synthetic peptide derived from erythropoietin (EPO) that is specifically engineered to retain tissue-protective properties without stimulating erythropoiesis. It is widely studied for its potential in anti-inflammatory, neuroprotective, and tissue repair research.

ARA-290 interacts with the innate repair receptor (IRR), making it a promising candidate in research related to chronic inflammation, neuropathic pain, and autoimmune conditions.

Product Details:

  • Peptide: ARA-290

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 10mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: Research use only. Not for human consumption or therapeutic use.

Potential Research Applications:

  • Anti-inflammatory pathway studies

  • Neuropathic pain models

  • Tissue protection and repair research

  • Innate repair receptor (IRR) exploration

Add to cart
-20%

BPC-157, TB-500 – “Wolverine Stack”

, ,
Price range: $56.00 through $84.00

BPC-157 and TB-500

BPC-157 + TB-500 – 10mg (Lyophilized Peptide Blend) – For Research Use Only

This advanced research peptide blend combines BPC-157 and TB-500 (Thymosin Beta-4 Fragment) — two well-studied peptides known for their potential in tissue repair, inflammation control, and accelerated recovery.

  • BPC-157 is a synthetic peptide derived from a gastric protein, studied for its possible role in gut health, tendon and ligament repair, and inflammation modulation.

  • TB-500 is a synthetic fragment of Thymosin Beta-4, researched for its potential to promote cell migration, angiogenesis, and muscle recovery.

Together, this combination is highly sought after in research models involving injury recovery, soft tissue repair, and anti-inflammatory studies.

Product Details:

  • Peptides: BPC-157 + TB-500 (5mg each unless otherwise specified)

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 10mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Injury recovery and soft tissue repair studies

  • Tendon, ligament, and muscle healing models

  • Anti-inflammatory and immune modulation research

  • Angiogenesis and cellular regeneration investigations

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

Select options This product has multiple variants. The options may be chosen on the product page
-20%
CJC-1295 DAC

CJC-1295 with DAC

, ,
Original price was: $59.00.Current price is: $47.20.

CJC-1295 with DAC

CJC-1295 with DAC – 5mg (Lyophilized Peptide) – For Research Use Only

CJC-1295 with DAC (Drug Affinity Complex) is a long-acting analog of Growth Hormone-Releasing Hormone (GHRH), designed to promote sustained release of growth hormone (GH) in research models. The DAC modification significantly extends its half-life, allowing for prolonged activity and making it ideal for studies on muscle growth, recovery, anti-aging, and fat metabolism.

CJC-1295 with DAC is often paired in research with peptides like Ipamorelin for synergistic GH axis stimulation.

Product Details:

  • Peptide: CJC-1295 with DAC

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 5mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Sustained growth hormone release studies

  • Muscle growth, recovery, and anti-aging research models

  • Fat metabolism and body composition investigations

  • Long-acting GHRH analog research

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

Add to cart
-19%
IGF-1 LR3

IGF-1 LR3

,
Original price was: $67.00.Current price is: $54.00.

IGF-1 LR3 1mg – Research Peptide

For Research Use Only – Not for Human ConsumptionIGF-1 LR3 (Long Arg3 Insulin-Like Growth Factor-1) is a synthetic peptide analog of human IGF-1. It has been modified to extend its half-life in vitro, allowing for enhanced stability and prolonged activity during laboratory testing. The substitution of arginine at position 3 and removal of the first three amino acids in the native IGF-1 sequence make LR3 more resistant to binding proteins, thereby increasing its bioavailability in research environments.Researchers value IGF-1 LR3 for its role in studying cellular growth, differentiation, survival pathways, and metabolic functions. It has been widely used in experimental models to explore muscle cell proliferation, neuroprotection, and regenerative mechanisms.Sequence: 83 amino acidsForm: Lyophilized powderPurity: ≥ 98% (HPLC Verified)Unit Size: 1mg vialStorage: Store lyophilized peptide at -4°F. Once reconstituted, keep refrigerated at 36–46°F.⚠ Disclaimer: All products are sold strictly for laboratory research use only. Not for human use, consumption, or therapeutic applications.
Add to cart
-17%Hot
ipamorelin

Ipamorelin

,
Price range: $26.00 through $35.00

Ipamorelin

Ipamorelin – 5mg (Lyophilized Peptide) – For Research Use Only

Ipamorelin is a selective Growth Hormone Secretagogue (GHS) studied for its ability to stimulate natural growth hormone (GH) release without significantly affecting cortisol or prolactin levels. Known for its clean safety profile in research models, Ipamorelin is commonly explored in studies on muscle growth, recovery, fat metabolism, and anti-aging.

Ipamorelin is often paired in research with other GH-releasing peptides like CJC-1295 No DAC for synergistic effects.

Product Details:

  • Peptide: Ipamorelin

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 5mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Growth hormone secretion and endocrine studies

  • Muscle growth, recovery, and anti-aging research models

  • Fat metabolism and body composition studies

  • GH axis and pituitary function investigations

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Select options This product has multiple variants. The options may be chosen on the product page
-21%

KissPeptin-10

,
Price range: $27.00 through $31.00

Kisspeptin-10

Kisspeptin-10 – 10mg (Lyophilized Peptide) – For Research Use Only

Kisspeptin-10 is a short-chain peptide fragment of the kisspeptin family, known for its regulatory role in the hypothalamic-pituitary-gonadal (HPG) axis. It is widely studied for its potential to influence GnRH (Gonadotropin-Releasing Hormone) secretion, making it a key subject in research on fertility, reproductive hormone modulation, and endocrine function.

Kisspeptin-10 has also been explored in studies related to puberty onset, reproductive health, and hormone signaling pathways.

Product Details:

  • Peptide: Kisspeptin-10 (Metastin 10 fragment)

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 10mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Fertility and reproductive hormone studies

  • HPG axis and GnRH secretion models

  • Endocrine signaling and modulation research

  • Studies on puberty and reproductive health

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Select options This product has multiple variants. The options may be chosen on the product page
-19%
KPV 10mg

KPV (Lysine-Proline-Valine)

,
Price range: $35.00 through $42.00
KPV – 10mg (Lyophilized Peptide) – For Research Use Only Lysine-Proline-Valine Tripeptide
KPV is a naturally occurring anti-inflammatory tripeptide derived from the C-terminal end of alpha-melanocyte-stimulating hormone (α-MSH). It is studied for its potent ability to modulate inflammatory responses and support immune regulation, particularly in research involving the gut, skin, and immune-related disorders.KPV has shown promising results in studies exploring intestinal permeability, colitis, dermatitis, and localized inflammation, making it a valuable peptide for advanced inflammation and healing research.

Product Details:

Peptide: KPV (Lys-Pro-Val)Purity: >98%Form: Lyophilized powderQuantity: 10mg per vialStorage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.Potential Research Applications:Gut health and intestinal inflammation models (e.g., IBD, leaky gut)Skin inflammation and dermatitis researchCytokine modulation and immune response studiesLocalized anti-inflammatory peptide therapy researchFor laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.
Select options This product has multiple variants. The options may be chosen on the product page
-20%
Melanotan 2

MT-2 (Melanotan 2) – 10mg

,
Original price was: $55.00.Current price is: $44.00.

Melanotan II (MT-2)

MT-2 (Melanotan 2) – 10mg (Lyophilized Peptide) – For Research Use Only

Melanotan 2 (MT-2) is a synthetic analog of the alpha-melanocyte-stimulating hormone (α-MSH), studied for its ability to activate melanocortin receptors involved in skin pigmentation, appetite regulation, and sexual function.
Research has focused on MT-2’s effects on melanin production, UV protection, libido, and energy balance in laboratory models.

Product Details:

  • Peptide: Melanotan 2 (MT-2)

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 10mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Melanogenesis and skin pigmentation studies

  • UV protection and tanning research models

  • Libido and sexual function investigations

  • Energy regulation and melanocortin receptor research

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Add to cart
-19%
Thymosin Alpha-1 Peptide

Thymosin Alpha-1

, ,
Original price was: $63.00.Current price is: $51.00.

Thymosin Alpha-1 (Tα1)

Thymosin Alpha-1 – Research Use Only

Thymosin Alpha-1 – 5mg (Lyophilized Peptide) – For Research Use Only

Thymosin Alpha-1 (Ta1) is a naturally occurring peptide fragment derived from prothymosin alpha, studied for its potential role in immune modulation, inflammation control, and cellular defense mechanisms. It has been of particular interest in research models exploring immune response enhancement, antiviral activity, and immune regulation.

Thymosin Alpha-1 is often studied in relation to immune system support, chronic infection models, and immune deficiency research.

Product Details:

  • Peptide: Thymosin Alpha-1

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 5mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption or therapeutic use.

Potential Research Applications:

  • Immune modulation and enhancement studies

  • Chronic infection and antiviral research models

  • Inflammatory response and cytokine regulation studies

  • Immune deficiency and autoimmune condition research

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Add to cart